PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g035300.1
Common NameMTR_7g035300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 234aa    MW: 27833.1 Da    PI: 5.3582
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g035300.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.63.2e-09120158545
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++eE+ +l +a++ +G + W+ I+r+++ gR +  +k++++
  Medtr7g035300.1 120 SEEEQNILDQAHNIFGDN-WTEISRRLP-GRNDSYVKNHLN 158
                      89**************77.*********.**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.9037199IPR017877Myb-like domain
SMARTSM007172775113IPR001005SANT/Myb domain
SuperFamilySSF466898.98E-1494160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-1394158IPR009057Homeodomain-like
PROSITE profilePS5129413.706111165IPR017930Myb domain
SMARTSM007173.8E-6115163IPR001005SANT/Myb domain
PfamPF002491.2E-6120158IPR001005SANT/Myb domain
CDDcd001671.47E-5120161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MFPMSQNDCS KYREYHMDEV NHHSSFATSY YKTADTNEIG HKYQDHDQEP VLIYHNQQKT  60
IQENNEIHHK YSNINAERWT TKENSIFVES VDLFLNRWTL KQCMERWYHL KPDIKNEPLS  120
EEEQNILDQA HNIFGDNWTE ISRRLPGRND SYVKNHLNAI KQVEDAKKKS MKMVKIENQP  180
NYIFEGLTTL EDELGGYVPM TFNDDYELYG LEFYPEAPMK KEINFMKMLC GNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-167915910102B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013448234.11e-177myb-like DNA-binding domain protein
TrEMBLA0A072TYJ91e-177A0A072TYJ9_MEDTR; Myb-like DNA-binding domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-20myb domain protein 98
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]